TCAP anticorps

N° du produit ABIN629822

Détail du produit anti-TCAP anticorps

Antigène: TCAP (Titin-Cap (Telethonin) (TCAP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TCAP est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: TCAP antibody was raised using a synthetic peptide corresponding to a region with amino acids IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TCAP Blocking Peptide, catalog no. 33R-4117, is also available for use as a blocking control in assays to test for specificity of this TCAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TCAP

Antigène: TCAP (Titin-Cap (Telethonin) (TCAP))

Autre désignation: TCAP (TCAP Produits)

Synonymes: anticorps TCAP, anticorps CMD1N, anticorps LGMD2G, anticorps T-cap, anticorps TELE, anticorps telethonin, anticorps AI503981, anticorps AJ223855, anticorps titin-cap, anticorps titin-cap (telethonin), anticorps titin-cap S homeolog, anticorps TCAP, anticorps tcap, anticorps tcap.S, anticorps Tcap

Sujet: Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.

Poids moléculaire: 19 kDa (MW of target protein)