HSD17B6 anticorps (N-Term)

N° du produit ABIN629831

Détail du produit anti-HSD17B6 anticorps

Antigène: HSD17B6 (Hydroxysteroid (17-Beta) Dehydrogenase 6 (HSD17B6))

Épitope: N-Term

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSD17B6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: HSD17 B6 antibody was raised against the N terminal of HSD17 6

Purification: Purified

Immunogène: HSD17 B6 antibody was raised using the N terminal of HSD17 6 corresponding to a region with amino acids MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSD17B6 Blocking Peptide, catalog no. 33R-6617, is also available for use as a blocking control in assays to test for specificity of this HSD17B6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSD17B6

Antigène: HSD17B6 (Hydroxysteroid (17-Beta) Dehydrogenase 6 (HSD17B6))

Autre désignation: HSD17B6 (HSD17B6 Produits)

Synonymes: anticorps HSE, anticorps RODH, anticorps SDR9C6, anticorps 17betaHSD9, anticorps Hsd17b9, anticorps Rdh8, anticorps hydroxysteroid 17-beta dehydrogenase 6, anticorps hydroxysteroid (17-beta) dehydrogenase 6, anticorps HSD17B6, anticorps Hsd17b6

Sujet: HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis