PRMT8 anticorps (C-Term)

N° du produit ABIN629836

Cet anticorps Lapin Polyclonal détecte spécifiquement PRMT8 dans WB. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour PRMT8 anticorps (C-Term) (ABIN629836)

Antigène: PRMT8 (Protein Arginine Methyltransferase 8 (PRMT8))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRMT8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PRMT8 anticorps

Épitope: C-Term

Specificité: PRMT8 antibody was raised against the C terminal of PRMT8

Purification: Purified

Immunogène: PRMT8 antibody was raised using the C terminal of PRMT8 corresponding to a region with amino acids YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRMT8 Blocking Peptide, (ABIN936132), is also available for use as a blocking control in assays to test for specificity of this PRMT8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRMT8

Antigène: PRMT8 (Protein Arginine Methyltransferase 8 (PRMT8))

Autre désignation: PRMT8

Sujet: PRMT8 probably methylates the guanidino nitrogens of arginyl residues in some proteins.

Poids moléculaire: 43 kDa (MW of target protein)