METTL13 anticorps (C-Term)

N° du produit ABIN629845

Cet anticorps Lapin Polyclonal détecte spécifiquement METTL13 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour METTL13 anticorps (C-Term) (ABIN629845)

Antigène: METTL13 (Methyltransferase Like 13 (METTL13))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL13 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-METTL13 anticorps

Épitope: C-Term

Specificité: KIAA0859 antibody was raised against the C terminal of KIAA0859

Purification: Purified

Immunogène: KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0859 Blocking Peptide, (ABIN5614331), is also available for use as a blocking control in assays to test for specificity of this KIAA0859 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0859 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL13

Antigène: METTL13 (Methyltransferase Like 13 (METTL13))

Autre désignation: KIAA0859

Sujet: The function of KIAA0859 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 60 kDa (MW of target protein)