RBP1 anticorps (Middle Region)

N° du produit ABIN629847

Cet anticorps anti-RBP1 est un anticorps Lapin Polyclonal détectant RBP1 dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour RBP1 anticorps (Middle Region) (ABIN629847)

Antigène: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RBP1 anticorps

Épitope: Middle Region

Specificité: RBP1 antibody was raised against the middle region of RBP1

Purification: Purified

Immunogène: RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBP1 Blocking Peptide, (ABIN939393), is also available for use as a blocking control in assays to test for specificity of this RBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBP1

Antigène: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Autre désignation: RBP1

Sujet: RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.

Poids moléculaire: 15 kDa (MW of target protein)