CUEDC1 anticorps (Middle Region)

N° du produit ABIN629850

Détail du produit anti-CUEDC1 anticorps

Antigène: CUEDC1 (CUE Domain Containing 1 (CUEDC1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CUEDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CUEDC1 antibody was raised against the middle region of CUEDC1

Purification: Purified

Immunogène: CUEDC1 antibody was raised using the middle region of CUEDC1 corresponding to a region with amino acids RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CUEDC1 Blocking Peptide, catalog no. 33R-8082, is also available for use as a blocking control in assays to test for specificity of this CUEDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUEDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CUEDC1

Antigène: CUEDC1 (CUE Domain Containing 1 (CUEDC1))

Autre désignation: CUEDC1 (CUEDC1 Produits)

Synonymes: anticorps AI841487, anticorps C330016O16Rik, anticorps RGD1304861, anticorps CUEDC1, anticorps zgc:153423, anticorps zgc:162271, anticorps CUE domain containing 1, anticorps CUE domain containing 1 L homeolog, anticorps CUE domain containing 1a, anticorps CUE domain containing 1b, anticorps CUEDC1, anticorps Cuedc1, anticorps cuedc1.L, anticorps cuedc1, anticorps cuedc1a, anticorps cuedc1b

Sujet: The function of CUE protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 42 kDa (MW of target protein)