FLJ14213 (N-Term) anticorps

N° du produit ABIN629854

Cet anticorps Lapin Polyclonal détecte spécifiquement FLJ14213 dans WB. Il présente une réactivité avec des échantillons de Chien, Humain, Souris et Rat.

Aperçu rapide pour FLJ14213 (N-Term) anticorps (ABIN629854)

Antigène: FLJ14213

Reactivité: Chien, Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Détail du produit

Épitope: N-Term

Specificité: FLJ14213 antibody was raised against the N terminal of FLJ14213

Purification: Purified

Immunogène: FLJ14213 antibody was raised using the N terminal of FLJ14213 corresponding to a region with amino acids SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLJ14213 Blocking Peptide, (ABIN5613604), is also available for use as a blocking control in assays to test for specificity of this FLJ14213 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ14213 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: FLJ14213

Sujet: FLJ14213 may be part of the TORC2 complex which plays a critical role in AKT1 'Ser-473' phosphorylation, and may modulate the phosphorylation of PKCA and regulate actin cytoskeleton organization

Poids moléculaire: 40 kDa (MW of target protein)