Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) anticorps

N° du produit ABIN629855

Détail du produit

Antigène: Chromosome 6 Open Reading Frame 134 (C6orf134)

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: C6 ORF134 antibody was raised against the N terminal Of C6 rf134

Purification: Purified

Immunogène: C6 ORF134 antibody was raised using the N terminal Of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C6ORF134 Blocking Peptide, catalog no. 33R-5915, is also available for use as a blocking control in assays to test for specificity of this C6ORF134 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF134 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Chromosome 6 Open Reading Frame 134 (C6orf134)

Autre désignation: C6ORF134 (C6orf134 Produits)

Synonymes: anticorps C6orf134, anticorps MEC17, anticorps Nbla00487, anticorps TAT, anticorps mec17, anticorps wu:fj19c03, anticorps zgc:65893, anticorps zgc:77443, anticorps Alpha-TAT, anticorps c6orf134, anticorps C23H6orf134, anticorps 0610011P08Rik, anticorps 2610008K08Rik, anticorps 2610110G12Rik, anticorps 3110080J08Rik, anticorps Mec17, anticorps RGD1303066, anticorps C7H6ORF134, anticorps C4H6orf134, anticorps alpha tubulin acetyltransferase 1, anticorps alpha tubulin acetyltransferase 1 S homeolog, anticorps ATAT1, anticorps atat1, anticorps atat1.S, anticorps Atat1

Sujet: The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 36 kDa (MW of target protein)