MORF4L1 anticorps (Middle Region)

N° du produit ABIN629857

Cet anticorps Lapin Polyclonal détecte spécifiquement MORF4L1 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour MORF4L1 anticorps (Middle Region) (ABIN629857)

Antigène: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MORF4L1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MORF4L1 anticorps

Épitope: Middle Region

Specificité: MORF4 L1 antibody was raised against the middle region of MORF4 1

Purification: Purified

Immunogène: MORF4 L1 antibody was raised using the middle region of MORF4 1 corresponding to a region with amino acids YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ

Information d'application

Indications d'application: WB: 5-10 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MORF4L1 Blocking Peptide, (ABIN936012), is also available for use as a blocking control in assays to test for specificity of this MORF4L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MORF4L1

Antigène: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Autre désignation: MORF4L1

Sujet: MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Chromatin Binding