STIP1 anticorps

N° du produit ABIN629861

L’anticorps Lapin Polyclonal anti-STIP1 a été validé pour WB. Il convient pour détecter STIP1 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour STIP1 anticorps (ABIN629861)

Antigène: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STIP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-STIP1 anticorps

Purification: Purified

Immunogène: STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STIP1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this STIP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STIP1

Antigène: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Autre désignation: STIP1

Sujet: STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).

Poids moléculaire: 63 kDa (MW of target protein)