IFI44L anticorps (N-Term)

N° du produit ABIN629863

Détail du produit anti-IFI44L anticorps

Antigène: IFI44L (Interferon-Induced Protein 44-Like (IFI44L))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFI44L est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: IFI44 L antibody was raised against the N terminal of IFI44

Purification: Purified

Immunogène: IFI44 L antibody was raised using the N terminal of IFI44 corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFI44L Blocking Peptide, catalog no. 33R-5983, is also available for use as a blocking control in assays to test for specificity of this IFI44L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFI44L

Antigène: IFI44L (Interferon-Induced Protein 44-Like (IFI44L))

Autre désignation: IFI44L (IFI44L Produits)

Synonymes: anticorps C1orf29, anticorps H-28, anticorps H28, anticorps H28-1, anticorps NS1178, anticorps IFI44L, anticorps interferon induced protein 44 like, anticorps interferon-induced protein 44 like, anticorps interferon-induced protein 44-like, anticorps IFI44L, anticorps Ifi44l, anticorps LOC100465846, anticorps LOC100538089, anticorps ifi44l

Sujet: The function of this gene remains unknown.

Poids moléculaire: 47 kDa (MW of target protein)