HSPB6 anticorps (Middle Region)

N° du produit ABIN629865

Cet anticorps anti-HSPB6 Polyclonal Lapin (ABIN629865) détecte spécifiquement HSPB6 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour HSPB6 anticorps (Middle Region) (ABIN629865)

Antigène: HSPB6 (Heat Shock Protein, alpha-Crystallin-Related, B6 (HSPB6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSPB6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HSPB6 anticorps

Épitope: Middle Region

Specificité: HSPB6 antibody was raised against the middle region of HSPB6

Purification: Purified

Immunogène: HSPB6 antibody was raised using the middle region of HSPB6 corresponding to a region with amino acids ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPB6 Blocking Peptide, (ABIN936860), is also available for use as a blocking control in assays to test for specificity of this HSPB6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPB6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSPB6

Antigène: HSPB6 (Heat Shock Protein, alpha-Crystallin-Related, B6 (HSPB6))

Autre désignation: HSPB6

Sujet: HSPB6 is associated with actin and modulates smooth muscle relaxation.HSPB6 is associated with actin and modulates smooth muscle relaxation.

Poids moléculaire: 17 kDa (MW of target protein)