Niban anticorps (N-Term)

N° du produit ABIN629867

L’anticorps Lapin Polyclonal anti-Niban a été validé pour WB. Il convient pour détecter Niban dans des échantillons de Humain.

Aperçu rapide pour Niban anticorps (N-Term) (ABIN629867)

Antigène: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Niban est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Niban anticorps

Épitope: N-Term

Specificité: FAM129 A antibody was raised against the N terminal of FAM129

Purification: Purified

Immunogène: FAM129 A antibody was raised using the N terminal of FAM129 corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM129A Blocking Peptide, (ABIN5613468), is also available for use as a blocking control in assays to test for specificity of this FAM129A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Niban

Antigène: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Autre désignation: FAM129A

Sujet: FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.

Poids moléculaire: 103 kDa (MW of target protein)