DDC anticorps

N° du produit ABIN629869

Cet anticorps Lapin Polyclonal détecte spécifiquement DDC dans WB et IHC. Il présente une réactivité envers Humain, Souris et Chien.

Aperçu rapide pour DDC anticorps (ABIN629869)

Antigène: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDC est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-DDC anticorps

Purification: Purified

Immunogène: DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDC Blocking Peptide, (ABIN937797), is also available for use as a blocking control in assays to test for specificity of this DDC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDC

Antigène: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Autre désignation: DDC

Sujet: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis