GGTLC1 anticorps (C-Term)

N° du produit ABIN629871

Détail du produit anti-GGTLC1 anticorps

Antigène: GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))

Épitope: C-Term

Reactivité: Humain, Chien, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GGTLC1 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificité: GGTLA4 antibody was raised against the C terminal of GGTLA4

Purification: Purified

Immunogène: GGTLA4 antibody was raised using the C terminal of GGTLA4 corresponding to a region with amino acids DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GGTLA4 Blocking Peptide, catalog no. 33R-2128, is also available for use as a blocking control in assays to test for specificity of this GGTLA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGTLA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GGTLC1

Antigène: GGTLC1 (gamma-Glutamyltransferase Light Chain 1 (GGTLC1))

Autre désignation: GGTLA4 (GGTLC1 Produits)

Synonymes: anticorps GGTL6, anticorps GGTLA3, anticorps GGTLA4, anticorps dJ831C21.1, anticorps dJ831C21.2, anticorps gamma-glutamyltransferase light chain 1, anticorps GGTLC1

Sujet: Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione.

Poids moléculaire: 25 kDa (MW of target protein)