CHD1L anticorps (Middle Region)

N° du produit ABIN629877

Cet anticorps anti-CHD1L est un anticorps Lapin Polyclonal détectant CHD1L dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour CHD1L anticorps (Middle Region) (ABIN629877)

Antigène: CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHD1L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHD1L anticorps

Épitope: Middle Region

Specificité: CHD1 L antibody was raised against the middle region of CHD1

Purification: Purified

Immunogène: CHD1 L antibody was raised using the middle region of CHD1 corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHD1L Blocking Peptide, (ABIN937245), is also available for use as a blocking control in assays to test for specificity of this CHD1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHD1L

Antigène: CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))

Autre désignation: CHD1L

Sujet: CHD1L encodes a protein that interacts with ADP-ribose. ADP-ribosylation of proteins is an important post-translational modification that occurs in a variety of biological processes, including DNA repair, transcription, chromatin biology and long-term memory formation.

Poids moléculaire: 45 kDa (MW of target protein)