TMEM108 anticorps (Middle Region)
-
- Antigène Voir toutes TMEM108 Anticorps
- TMEM108 (Transmembrane Protein 108 (TMEM108))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM108 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM108 antibody was raised against the middle region of TMEM108
- Purification
- Purified
- Immunogène
- TMEM108 antibody was raised using the middle region of TMEM108 corresponding to a region with amino acids NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI
- Top Product
- Discover our top product TMEM108 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM108 Blocking Peptide, catalog no. 33R-6859, is also available for use as a blocking control in assays to test for specificity of this TMEM108 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM108 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM108 (Transmembrane Protein 108 (TMEM108))
- Autre désignation
- TMEM108 (TMEM108 Produits)
- Synonymes
- anticorps TMEM108, anticorps CT124, anticorps AI462967, anticorps B130017P16Rik, anticorps R74726, anticorps RGD1311530, anticorps transmembrane protein 108, anticorps TMEM108, anticorps Tmem108
- Sujet
- TMEM108's function has not been determined yet.
- Poids moléculaire
- 54 kDa (MW of target protein)
-