DDX49 anticorps
-
- Antigène Voir toutes DDX49 Anticorps
- DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDX49 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR
- Top Product
- Discover our top product DDX49 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDX49 Blocking Peptide, catalog no. 33R-2530, is also available for use as a blocking control in assays to test for specificity of this DDX49 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX49 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))
- Autre désignation
- DDX49 (DDX49 Produits)
- Synonymes
- anticorps MGC76291, anticorps r27090_2, anticorps DDX49, anticorps wu:fb82g04, anticorps wu:fd12e05, anticorps ddx49-a, anticorps R27090_2, anticorps DEAD-box helicase 49, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 49, anticorps DEAD-box helicase 49 S homeolog, anticorps ddx49, anticorps DDX49, anticorps ddx49.S, anticorps Ddx49
- Sujet
- The function of Anti-DDX49 has not yet been determined.
- Poids moléculaire
- 53 kDa (MW of target protein)
-