SRSF1 anticorps

N° du produit ABIN629883

Cet anticorps anti-SRSF1 est un anticorps Lapin Polyclonal détectant SRSF1 dans WB. Adapté pour Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour SRSF1 anticorps (ABIN629883)

Antigène: SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRSF1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SRSF1 anticorps

Purification: Purified

Immunogène: SFRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRS

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS1 Blocking Peptide, (ABIN939044), is also available for use as a blocking control in assays to test for specificity of this SFRS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRSF1

Antigène: SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))

Autre désignation: SFRS1

Sujet: SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization