CSDC2 anticorps (N-Term)

N° du produit ABIN629884

Cet anticorps Lapin Polyclonal détecte spécifiquement CSDC2 dans WB et IHC. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour CSDC2 anticorps (N-Term) (ABIN629884)

Antigène: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSDC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CSDC2 anticorps

Épitope: N-Term

Specificité: CSDC2 antibody was raised against the N terminal of CSDC2

Purification: Purified

Immunogène: CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP

Information d'application

Indications d'application: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CSDC2 Blocking Peptide, (ABIN5613012), is also available for use as a blocking control in assays to test for specificity of this CSDC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSDC2

Antigène: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Autre désignation: CSDC2

Sujet: CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.

Poids moléculaire: 17 kDa (MW of target protein)