HNRNPK anticorps (C-Term)

N° du produit ABIN629892

Détail du produit anti-HNRNPK anticorps

Antigène: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPK est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: HNRPK antibody was raised against the C terminal of HNRPK

Purification: Purified

Immunogène: HNRPK antibody was raised using the C terminal of HNRPK corresponding to a region with amino acids YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPK Blocking Peptide, catalog no. 33R-10254, is also available for use as a blocking control in assays to test for specificity of this HNRPK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPK

Antigène: HNRNPK (Heterogeneous Nuclear Ribonucleoprotein K (HNRNPK))

Autre désignation: HNRPK (HNRNPK Produits)

Synonymes: anticorps CSBP, anticorps HNRPK, anticorps TUNP, anticorps Csbp, anticorps Hnrpk, anticorps hnrpk, anticorps MGC75642, anticorps wu:fb37h02, anticorps wu:fi34c04, anticorps zgc:66162, anticorps KBBP, anticorps NOVA, anticorps heterogeneous nuclear ribonucleoprotein K, anticorps heterogeneous nuclear ribonucleoprotein K S homeolog, anticorps heterogeneous nuclear ribonucleoprotein k, anticorps HNRNPK, anticorps Hnrnpk, anticorps hnrnpk.S, anticorps hnrnpk, anticorps LOC5565718, anticorps CpipJ_CPIJ000130, anticorps NGK_p0004

Sujet: HNRPK belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Poids moléculaire: 51 kDa (MW of target protein)