HNRNPD/AUF1 anticorps

N° du produit ABIN629893

Cet anticorps Lapin Polyclonal détecte spécifiquement HNRNPD/AUF1 dans WB et IHC. Il présente une réactivité envers Humain, Rat et Chien.

Aperçu rapide pour HNRNPD/AUF1 anticorps (ABIN629893)

Antigène: HNRNPD/AUF1 (HNRNPD) (Heterogeneous Nuclear Ribonucleoprotein D (HNRNPD))

Reactivité: Humain, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPD/AUF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-HNRNPD/AUF1 anticorps

Purification: Purified

Immunogène: HNRPD antibody was raised using a synthetic peptide corresponding to a region with amino acids YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPD Blocking Peptide, (ABIN936079), is also available for use as a blocking control in assays to test for specificity of this HNRPD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPD/AUF1

Antigène: HNRNPD/AUF1 (HNRNPD) (Heterogeneous Nuclear Ribonucleoprotein D (HNRNPD))

Autre désignation: HNRPD

Sujet: HNRPD belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

Poids moléculaire: 39 kDa (MW of target protein)