THO Complex 4 anticorps (N-Term)

N° du produit ABIN629900

Détail du produit anti-THO Complex 4 anticorps

Antigène: THO Complex 4 (THOC4)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp THO Complex 4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: THOC4 antibody was raised against the N terminal of THOC4

Purification: Purified

Immunogène: THOC4 antibody was raised using the N terminal of THOC4 corresponding to a region with amino acids GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGA

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THOC4 Blocking Peptide, catalog no. 33R-3282, is also available for use as a blocking control in assays to test for specificity of this THOC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur THO Complex 4

Antigène: THO Complex 4 (THOC4)

Autre désignation: THOC4 (THOC4 Produits)

Synonymes: anticorps THOC4, anticorps Aly, anticorps ALY, anticorps ALY/REF, anticorps BEF, anticorps REF, anticorps tho4, anticorps thoc4, anticorps zgc:171753, anticorps Tho4-A, anticorps alyref-a, anticorps thoc4-a, anticorps REF1, anticorps Refbp1, anticorps Thoc4, anticorps Tho4, anticorps Aly/REF export factor, anticorps THO complex 4, anticorps Aly/REF export factor L homeolog, anticorps ALYREF, anticorps Thoc4, anticorps alyref, anticorps alyref.L, anticorps Alyref

Sujet: THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.

Poids moléculaire: 28 kDa (MW of target protein)