HNRNPL anticorps (N-Term)

N° du produit ABIN629902

Cet anticorps Lapin Polyclonal détecte spécifiquement HNRNPL dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour HNRNPL anticorps (N-Term) (ABIN629902)

Antigène: HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPL est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-HNRNPL anticorps

Épitope: N-Term

Specificité: HNRPL antibody was raised against the N terminal of HNRPL

Purification: Purified

Immunogène: HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPL Blocking Peptide, (ABIN937597), is also available for use as a blocking control in assays to test for specificity of this HNRPL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPL

Antigène: HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))

Autre désignation: HNRPL

Sujet: Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA.

Poids moléculaire: 65 kDa (MW of target protein)