EXOSC4 anticorps (N-Term)

N° du produit ABIN629903

L’anticorps Lapin Polyclonal anti-EXOSC4 a été validé pour WB et IHC. Il convient pour détecter EXOSC4 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour EXOSC4 anticorps (N-Term) (ABIN629903)

Antigène: EXOSC4 (Exosome Component 4 (EXOSC4))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOSC4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-EXOSC4 anticorps

Épitope: N-Term

Specificité: EXOSC4 antibody was raised against the N terminal of EXOSC4

Purification: Purified

Immunogène: EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOSC4 Blocking Peptide, (ABIN5613435), is also available for use as a blocking control in assays to test for specificity of this EXOSC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOSC4

Antigène: EXOSC4 (Exosome Component 4 (EXOSC4))

Autre désignation: EXOSC4

Sujet: EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.

Poids moléculaire: 27 kDa (MW of target protein)