EXOSC10 anticorps (C-Term)

N° du produit ABIN629904

Cet anticorps anti-EXOSC10 est un anticorps Lapin Polyclonal détectant EXOSC10 dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour EXOSC10 anticorps (C-Term) (ABIN629904)

Antigène: EXOSC10 (Exosome Component 10 (EXOSC10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOSC10 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-EXOSC10 anticorps

Épitope: C-Term

Specificité: EXOSC10 antibody was raised against the C terminal of EXOSC10

Purification: Purified

Immunogène: EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOSC10 Blocking Peptide, (ABIN938228), is also available for use as a blocking control in assays to test for specificity of this EXOSC10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOSC10

Antigène: EXOSC10 (Exosome Component 10 (EXOSC10))

Autre désignation: EXOSC10

Sujet: EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.

Poids moléculaire: 97 kDa (MW of target protein)