RPP29 anticorps

N° du produit ABIN629915

Détail du produit anti-RPP29 anticorps

Antigène: RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPP29 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: POP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POP4 Blocking Peptide, catalog no. 33R-2327, is also available for use as a blocking control in assays to test for specificity of this POP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPP29

Antigène: RPP29 (POP4) (Processing of Precursor 4, Ribonuclease P/MRP Subunit (POP4))

Autre désignation: POP4 (POP4 Produits)

Synonymes: anticorps POP4, anticorps RPP29, anticorps 1110023P21Rik, anticorps Rpp29, anticorps zgc:110597, anticorps rpp29, anticorps POP4 homolog, ribonuclease P/MRP subunit, anticorps processing of precursor 4, ribonuclease P/MRP family, (S. cerevisiae), anticorps POP4 homolog, ribonuclease P/MRP subunit L homeolog, anticorps POP4, anticorps Pop4, anticorps pop4, anticorps pop4.L

Sujet: POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.

Poids moléculaire: 24 kDa (MW of target protein)