Trnt1 anticorps (N-Term)

N° du produit ABIN629918

Détail du produit anti-Trnt1 anticorps

Antigène: Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Trnt1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: TRNT1 antibody was raised against the N terminal of TRNT1

Purification: Purified

Immunogène: TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRNT1 Blocking Peptide, catalog no. 33R-7294, is also available for use as a blocking control in assays to test for specificity of this TRNT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Trnt1

Antigène: Trnt1 (tRNA Nucleotidyl Transferase, CCA-Adding, 1 (Trnt1))

Autre désignation: TRNT1 (Trnt1 Produits)

Synonymes: anticorps bMtCCA, anticorps zgc:86645, anticorps cca1, anticorps mtcca, anticorps cgi-47, anticorps TRNT1, anticorps CCA1, anticorps MtCCA, anticorps 2410043H24Rik, anticorps 2610044E04Rik, anticorps 9830143O18Rik, anticorps AA408384, anticorps C76540, anticorps CGI-47, anticorps mt-Trat, anticorps tRNA nucleotidyl transferase 1, anticorps tRNA nucleotidyl transferase, CCA-adding, 1, anticorps tRNA nucleotidyl transferase, CCA-adding, 1 L homeolog, anticorps TRNT1, anticorps trnt1, anticorps trnt1.L, anticorps Trnt1

Sujet: TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.

Poids moléculaire: 45 kDa (MW of target protein)