Nucleolar Protein 6 anticorps

N° du produit ABIN629920

Cet anticorps Lapin Polyclonal détecte spécifiquement Nucleolar Protein 6 dans WB et IHC. Il présente une réactivité envers Humain.

Aperçu rapide pour Nucleolar Protein 6 anticorps (ABIN629920)

Antigène: Nucleolar Protein 6 (NOL6)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nucleolar Protein 6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Nucleolar Protein 6 anticorps

Purification: Purified

Immunogène: NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOL6 Blocking Peptide, (ABIN5615022), is also available for use as a blocking control in assays to test for specificity of this NOL6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nucleolar Protein 6

Antigène: Nucleolar Protein 6 (NOL6)

Autre désignation: NOL6

Sujet: NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts.

Poids moléculaire: 22 kDa (MW of target protein)