Fibrillarin anticorps (N-Term)

N° du produit ABIN629933

L’anticorps Lapin Polyclonal anti-Fibrillarin a été validé pour WB et IHC. Il convient pour détecter Fibrillarin dans des échantillons de Humain, Rat, Souris et Chien.

Aperçu rapide pour Fibrillarin anticorps (N-Term) (ABIN629933)

Antigène: Fibrillarin (FBL)

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fibrillarin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Fibrillarin anticorps

Épitope: N-Term

Specificité: Fibrillarin antibody was raised against the N terminal of FBL

Purification: Purified

Immunogène: Fibrillarin antibody was raised using the N terminal of FBL corresponding to a region with amino acids GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Fibrillarin Blocking Peptide, (ABIN938665), is also available for use as a blocking control in assays to test for specificity of this Fibrillarin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fibrillarin

Antigène: Fibrillarin (FBL)

Autre désignation: Fibrillarin

Sujet: FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognise fibrillarin.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process