Fibrillarin anticorps (N-Term)

N° du produit ABIN629933

Détail du produit anti-Fibrillarin anticorps

Antigène: Fibrillarin (FBL)

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fibrillarin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Fibrillarin antibody was raised against the N terminal of FBL

Purification: Purified

Immunogène: Fibrillarin antibody was raised using the N terminal of FBL corresponding to a region with amino acids GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Fibrillarin Blocking Peptide, catalog no. 33R-3279, is also available for use as a blocking control in assays to test for specificity of this Fibrillarin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fibrillarin

Antigène: Fibrillarin (FBL)

Autre désignation: Fibrillarin (FBL Produits)

Synonymes: anticorps FIB, anticorps FLRN, anticorps RNU3IP1, anticorps wu:fb37g12, anticorps zgc:56145, anticorps zgc:77130, anticorps FBL, anticorps AL022665, anticorps CG9888, anticorps Dmel\\CG9888, anticorps Fibri, anticorps GCR-6, anticorps GCR6, anticorps Pen59C5, anticorps fib, anticorps pen59C5, anticorps MGC76139, anticorps fbl, anticorps fibrillarin, anticorps Fibrillarin, anticorps putative fibrillarin, anticorps fibrillarin S homeolog, anticorps FBL, anticorps fbl, anticorps Fbl, anticorps Fib, anticorps fib1, anticorps LMJF_19_0100, anticorps fbl.S

Sujet: FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognise fibrillarin.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process