TROVE2 anticorps (N-Term)
-
- Antigène Voir toutes TROVE2 Anticorps
- TROVE2 (TROVE Domain Family, Member 2 (TROVE2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TROVE2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- TROVE2 antibody was raised against the N terminal of TROVE2
- Purification
- Purified
- Immunogène
- TROVE2 antibody was raised using the N terminal of TROVE2 corresponding to a region with amino acids QKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS
- Top Product
- Discover our top product TROVE2 Anticorps primaire
-
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 3-535) antibody
TROVE2 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 1-100) antibodyTROVE2 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 1F2 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (Center) antibodyTROVE2 Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 1-538) antibodyTROVE2 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 2E10 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (N-Term) antibodyTROVE2 Reactivité: Humain WB, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 51-100) antibodyTROVE2 Reactivité: Humain, Cheval, Porc WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) antibodyTROVE2 Reactivité: Humain WB, ELISA, IHC, IHC (p) Hôte: Souris Monoclonal 2B4 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 20-69) antibodyTROVE2 Reactivité: Humain, Souris, Chien, Cobaye, Lapin, Singe, Roussette (Chauve-souris) WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 467-495), (C-Term) antibodyTROVE2 Reactivité: Humain WB Hôte: Lapin Polyclonal RB36981 unconjugated
anti-TROVE Domain Family, Member 2 (TROVE2) (AA 1-100) antibodyTROVE2 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TROVE2 Blocking Peptide, catalog no. 33R-7607, is also available for use as a blocking control in assays to test for specificity of this TROVE2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TROVE2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TROVE2 (TROVE Domain Family, Member 2 (TROVE2))
- Autre désignation
- TROVE2 (TROVE2 Produits)
- Synonymes
- anticorps SSA2, anticorps TROVE2, anticorps ssa2, anticorps ssa2-A, anticorps RO60, anticorps RORNP, anticorps 1810007I17Rik, anticorps A530054J02Rik, anticorps AI646302, anticorps SS-A/Ro, anticorps Ssa, anticorps Ssa2, anticorps TROVE domain family member 2, anticorps TROVE domain family, member 2, anticorps TROVE domain family member 2 L homeolog, anticorps TROVE2, anticorps trove2, anticorps trove2.L, anticorps Trove2
- Sujet
- As a RNA-binding protein, TROVE2 binds to several small cytoplasmic RNA molecules known as Y RNAs. It may stabilize these RNAs from degradation.
- Poids moléculaire
- 58 kDa (MW of target protein)
-
