TARBP2 anticorps

N° du produit ABIN629947

Cet anticorps Lapin Polyclonal détecte spécifiquement TARBP2 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris, Rat et Poisson zèbre (Danio rerio).

Aperçu rapide pour TARBP2 anticorps (ABIN629947)

Antigène: TARBP2 (TAR (HIV-1) RNA Binding Protein 2 (TARBP2))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TARBP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TARBP2 anticorps

Purification: Purified

Immunogène: TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TARBP2 Blocking Peptide, (ABIN936791), is also available for use as a blocking control in assays to test for specificity of this TARBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TARBP2

Antigène: TARBP2 (TAR (HIV-1) RNA Binding Protein 2 (TARBP2))

Autre désignation: TARBP2

Sujet: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARBP2 binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein.

Poids moléculaire: 8 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Ribonucleoprotein Complex Subunit Organization