TARBP2 anticorps

N° du produit ABIN629947

Détail du produit anti-TARBP2 anticorps

Antigène: TARBP2 (TAR (HIV-1) RNA Binding Protein 2 (TARBP2))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TARBP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TARBP2 Blocking Peptide, catalog no. 33R-1405, is also available for use as a blocking control in assays to test for specificity of this TARBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TARBP2

Antigène: TARBP2 (TAR (HIV-1) RNA Binding Protein 2 (TARBP2))

Autre désignation: TARBP2 (TARBP2 Produits)

Synonymes: anticorps trbp, anticorps trbp1, anticorps trbp2, anticorps MGC97783, anticorps TARBP2, anticorps LOQS, anticorps TRBP, anticorps TRBP1, anticorps TRBP2, anticorps fj51e12, anticorps wu:fj51e12, anticorps zgc:63778, anticorps Prbp, anticorps TAR (HIV-1) RNA binding protein 2, anticorps TARBP2, RISC loading complex RNA binding subunit, anticorps TAR (HIV-1) RNA binding protein 2 L homeolog, anticorps TAR (HIV) RNA binding protein 2, anticorps tarbp2, anticorps TARBP2, anticorps tarbp2.L, anticorps Tarbp2

Sujet: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARBP2 binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein.

Poids moléculaire: 8 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Ribonucleoprotein Complex Subunit Organization