DDX55 anticorps

N° du produit ABIN629953

Détail du produit anti-DDX55 anticorps

Antigène: DDX55 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 55 (DDX55))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX55 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX55 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX55 Blocking Peptide, catalog no. 33R-3374, is also available for use as a blocking control in assays to test for specificity of this DDX55 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX55

Antigène: DDX55 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 55 (DDX55))

Autre désignation: DDX55 (DDX55 Produits)

Synonymes: anticorps 2810021H22Rik, anticorps mKIAA1595, anticorps chunp6861, anticorps fc32a12, anticorps kiaa1595, anticorps wu:fc32a12, anticorps ddx55, anticorps MGC78784, anticorps DDX55, anticorps DEAD-box helicase 55, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 55, anticorps DEAD-box helicase 55 S homeolog, anticorps DDX55, anticorps Ddx55, anticorps ddx55, anticorps ddx55.S

Sujet: Anti-DDX55 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Multiple alternatively spliced transcript variants have been found for Anti-DDX55, but the biological validity of only one transcript has been confirmed.

Poids moléculaire: 66 kDa (MW of target protein)