DDX5 anticorps

N° du produit ABIN629955

Détail du produit anti-DDX5 anticorps

Antigène: DDX5 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX5 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX5 Blocking Peptide, catalog no. 33R-8427, is also available for use as a blocking control in assays to test for specificity of this DDX5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX5

Antigène: DDX5 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 5 (DDX5))

Autre désignation: DDX5 (DDX5 Produits)

Synonymes: anticorps G17P1, anticorps HLR1, anticorps HUMP68, anticorps p68, anticorps 2600009A06Rik, anticorps Hlr1, anticorps wu:fa56a07, anticorps wu:fb11e01, anticorps wu:fb16c10, anticorps wu:fb53b05, anticorps ddx5, anticorps DEAD-box helicase 5, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 5, anticorps DEAD (Asp-Glu-Ala-Asp) box helicase 5, anticorps DEAD-box helicase 5 L homeolog, anticorps DDX5, anticorps Ddx5, anticorps ddx5, anticorps ddx5.L

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding, Regulation of Muscle Cell Differentiation, Positive Regulation of Response to DNA Damage Stimulus