DDX23 anticorps

N° du produit ABIN629956

Détail du produit anti-DDX23 anticorps

Antigène: DDX23 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 23 (DDX23))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX23 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX23 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX23 Blocking Peptide, catalog no. 33R-2328, is also available for use as a blocking control in assays to test for specificity of this DDX23 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX23

Antigène: DDX23 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 23 (DDX23))

Autre désignation: DDX23 (DDX23 Produits)

Synonymes: anticorps PRPF28, anticorps SNRNP100, anticorps U5-100K, anticorps U5-100KD, anticorps prp28, anticorps wu:fi39b12, anticorps zgc:63742, anticorps 3110082M05Rik, anticorps 4921506D17Rik, anticorps DEAD-box helicase 23, anticorps U5 snRNP 100 kD protein, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 23, anticorps DDX23, anticorps cgd3_3690, anticorps Chro.30417, anticorps PY04051, anticorps ddx23, anticorps Ddx23

Sujet: DDX23 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Poids moléculaire: 90 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization