DDX46 anticorps

N° du produit ABIN629960

L’anticorps Lapin Polyclonal anti-DDX46 a été validé pour WB. Il convient pour détecter DDX46 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour DDX46 anticorps (ABIN629960)

Antigène: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX46 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DDX46 anticorps

Purification: Purified

Immunogène: DDX46 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX46 Blocking Peptide, (ABIN938633), is also available for use as a blocking control in assays to test for specificity of this DDX46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX46

Antigène: DDX46 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 46 (DDX46))

Autre désignation: DDX46

Sujet: DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex, it plays an important role in pre-mRNA splicing.

Poids moléculaire: 113 kDa (MW of target protein)