MATR3 anticorps (C-Term)
-
- Antigène Voir toutes MATR3 Anticorps
- MATR3 (Matrin 3 (MATR3))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MATR3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Matrin 3 antibody was raised against the C terminal of MATR3
- Purification
- Purified
- Immunogène
- Matrin 3 antibody was raised using the C terminal of MATR3 corresponding to a region with amino acids ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG
- Top Product
- Discover our top product MATR3 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Matrin 3 Blocking Peptide, catalog no. 33R-1084, is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATR3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MATR3 (Matrin 3 (MATR3))
- Autre désignation
- Matrin 3 (MATR3 Produits)
- Synonymes
- anticorps MPD2, anticorps VCPDM, anticorps 1110061A14Rik, anticorps 2810017I02Rik, anticorps AI841759, anticorps AW555618, anticorps D030046F20Rik, anticorps mKIAA0723, anticorps P130/MAT3, anticorps matrin-3, anticorps matr3, anticorps MGC79524, anticorps MATR3, anticorps DKFZp459A057, anticorps DKFZp459A162, anticorps DKFZp459F0515, anticorps DKFZp469A1933, anticorps LOC100232255, anticorps KIAA0723, anticorps matrin 3, anticorps matrin 3 S homeolog, anticorps MATR3, anticorps Matr3, anticorps matr3.S, anticorps matr3
- Sujet
- MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.
- Poids moléculaire
- 94 kDa (MW of target protein)
-