MATR3 anticorps (C-Term)

N° du produit ABIN629963

L’anticorps anti-MATR3 Polyclonal Lapin est utilisé pour la détection de MATR3 dans des échantillons de Humain et Souris. Il a été validé pour WB.

Aperçu rapide pour MATR3 anticorps (C-Term) (ABIN629963)

Antigène: MATR3 (Matrin 3 (MATR3))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MATR3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MATR3 anticorps

Épitope: C-Term

Specificité: Matrin 3 antibody was raised against the C terminal of MATR3

Purification: Purified

Immunogène: Matrin 3 antibody was raised using the C terminal of MATR3 corresponding to a region with amino acids ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Matrin 3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MATR3

Antigène: MATR3 (Matrin 3 (MATR3))

Autre désignation: Matrin 3

Sujet: MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.

Poids moléculaire: 94 kDa (MW of target protein)