RPS14 anticorps (N-Term)

N° du produit ABIN629966

L’anticorps Lapin Polyclonal anti-RPS14 a été validé pour WB. Il convient pour détecter RPS14 dans des échantillons de Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour RPS14 anticorps (N-Term) (ABIN629966)

Antigène: RPS14 (Ribosomal Protein S14 (RPS14))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS14 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RPS14 anticorps

Épitope: N-Term

Specificité: RPS14 antibody was raised against the N terminal of RPS14

Purification: Purified

Immunogène: RPS14 antibody was raised using the N terminal of RPS14 corresponding to a region with amino acids APRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS14 Blocking Peptide, (ABIN936823), is also available for use as a blocking control in assays to test for specificity of this RPS14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS14

Antigène: RPS14 (Ribosomal Protein S14 (RPS14))

Autre désignation: RPS14

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly