RPS14 anticorps (N-Term)
-
- Antigène Voir toutes RPS14 Anticorps
- RPS14 (Ribosomal Protein S14 (RPS14))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPS14 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPS14 antibody was raised against the N terminal of RPS14
- Purification
- Purified
- Immunogène
- RPS14 antibody was raised using the N terminal of RPS14 corresponding to a region with amino acids APRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKE
- Top Product
- Discover our top product RPS14 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPS14 Blocking Peptide, catalog no. 33R-1437, is also available for use as a blocking control in assays to test for specificity of this RPS14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPS14 (Ribosomal Protein S14 (RPS14))
- Autre désignation
- RPS14 (RPS14 Produits)
- Synonymes
- anticorps EMTB, anticorps S14, anticorps 2600014J02Rik, anticorps AL023078, anticorps fa92e08, anticorps wu:fa92e08, anticorps zgc:73215, anticorps CG1527, anticorps Dmel\CG1527, anticorps RPS14B, anticorps RpS14, anticorps RpS14B, anticorps S14b, anticorps anon-EST:Posey115, anticorps anon-EST:Posey131, anticorps anon-EST:Posey154, anticorps anon-EST:Posey77, anticorps rpS14B, anticorps ribosomal protein S14, anticorps 40S ribosomal protein S14, anticorps ribosomal protein S14 L homeolog, anticorps 30S ribosomal protein S14, anticorps Ribosomal protein S14b, anticorps mitochondrial ribosomal protein S14, anticorps RPS14, anticorps Rps14, anticorps rps-14, anticorps rps14, anticorps rps14.L, anticorps LOC100286294, anticorps RpS14, anticorps RpS14b, anticorps MRPS14
- Sujet
- Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.
- Poids moléculaire
- 17 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-