CELF2 anticorps (N-Term)

N° du produit ABIN629968

Cet anticorps Lapin Polyclonal détecte spécifiquement CELF2 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat, Poisson zèbre (Danio rerio) et Chien.

Aperçu rapide pour CELF2 anticorps (N-Term) (ABIN629968)

Antigène: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CELF2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CELF2 anticorps

Épitope: N-Term

Specificité: CUGBP2 antibody was raised against the N terminal of CUGBP2

Purification: Purified

Immunogène: CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CUGBP2 Blocking Peptide, (ABIN5613034), is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CELF2

Antigène: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Autre désignation: CUGBP2

Sujet: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization