CELF2 anticorps (N-Term)

N° du produit ABIN629968

Détail du produit anti-CELF2 anticorps

Antigène: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CELF2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CUGBP2 antibody was raised against the N terminal of CUGBP2

Purification: Purified

Immunogène: CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CUGBP2 Blocking Peptide, catalog no. 33R-9924, is also available for use as a blocking control in assays to test for specificity of this CUGBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CELF2

Antigène: CELF2 (CUGBP, Elav-Like Family Member 2 (CELF2))

Autre désignation: CUGBP2 (CELF2 Produits)

Synonymes: anticorps CUGBP2, anticorps BRUNOL3, anticorps ETR-3, anticorps ETR3, anticorps NAPOR, anticorps B230218O03, anticorps B230345P09Rik, anticorps C88023, anticorps CELF-2, anticorps CUG-BP2, anticorps Cugbp2, anticorps D230046B21Rik, anticorps Etr-3, anticorps Napor, anticorps Napor-2, anticorps mETR-3, anticorps cb906, anticorps cugbp2, anticorps fj87b07, anticorps wu:fj87b07, anticorps brunol3, anticorps celf2, anticorps cugbp2-a, anticorps etr3, anticorps napor, anticorps Brunol3, anticorps Etr3, anticorps CUGBP Elav-like family member 2, anticorps CUGBP, Elav-like family member 2, anticorps cugbp, Elav-like family member 2, anticorps CUGBP, Elav-like family member 2 L homeolog, anticorps CELF2, anticorps Celf2, anticorps celf2, anticorps celf2.L

Sujet: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization