DDX6 anticorps

N° du produit ABIN629973

Cet anticorps anti-DDX6 est un anticorps Lapin Polyclonal détectant DDX6 dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour DDX6 anticorps (ABIN629973)

Antigène: DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DDX6 anticorps

Purification: Purified

Immunogène: DDX6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX6 Blocking Peptide, (ABIN940070), is also available for use as a blocking control in assays to test for specificity of this DDX6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX6

Antigène: DDX6 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 6 (DDX6))

Autre désignation: DDX6

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX6 encodes a DEAD box protein. It may contribute to the cell proliferation and carcinogenesis.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization