EIF3G anticorps (N-Term)

N° du produit ABIN629975

L’anticorps Lapin Polyclonal anti-EIF3G a été validé pour WB et IHC. Il convient pour détecter EIF3G dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour EIF3G anticorps (N-Term) (ABIN629975)

Antigène: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF3G est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-EIF3G anticorps

Épitope: N-Term

Specificité: EIF3 S4 antibody was raised against the N terminal of EIF3 4

Purification: Purified

Immunogène: EIF3 S4 antibody was raised using the N terminal of EIF3 4 corresponding to a region with amino acids SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF3S4 Blocking Peptide, (ABIN5613335), is also available for use as a blocking control in assays to test for specificity of this EIF3S4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF3G

Antigène: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Autre désignation: EIF3S4

Sujet: EIF3S4 contains 1 RRM (RNA recognition motif) domain. It binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization