EIF3G anticorps (N-Term)
-
- Antigène Voir toutes EIF3G Anticorps
- EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EIF3G est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- EIF3 S4 antibody was raised against the N terminal of EIF3 4
- Purification
- Purified
- Immunogène
- EIF3 S4 antibody was raised using the N terminal of EIF3 4 corresponding to a region with amino acids SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK
- Top Product
- Discover our top product EIF3G Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EIF3S4 Blocking Peptide, catalog no. 33R-8672, is also available for use as a blocking control in assays to test for specificity of this EIF3S4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))
- Autre désignation
- EIF3S4 (EIF3G Produits)
- Synonymes
- anticorps EIF3-P42, anticorps EIF3S4, anticorps eIF3-delta, anticorps eIF3-p44, anticorps 44kDa, anticorps D0Jmb4, anticorps Eif3s4, anticorps TU-189B2, anticorps p44, anticorps eif3s4, anticorps zgc:56553, anticorps eIF3g-A, anticorps eif3s4-A, anticorps eIF3g, anticorps eIF3-S4, anticorps An16g05260, anticorps AO090011000648, anticorps eukaryotic translation initiation factor 3 subunit G, anticorps eukaryotic translation initiation factor 3, subunit G, anticorps eukaryotic translation initiation factor 3 subunit G S homeolog, anticorps Eukaryotic translation initiation factor 3 subunit G, anticorps eukaryotic translation initiation factor, anticorps EIF3G, anticorps Eif3g, anticorps eif3g, anticorps eif3g.S, anticorps eif-3.G, anticorps eIF3g, anticorps ANI_1_732144, anticorps AOR_1_1112054, anticorps VDBG_00824, anticorps MGYG_08099, anticorps Tsp_04379
- Sujet
- EIF3S4 contains 1 RRM (RNA recognition motif) domain. It binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-