SRP14 anticorps

N° du produit ABIN629979

Cet anticorps anti-SRP14 est un anticorps Lapin Polyclonal détectant SRP14 dans WB et IHC. Adapté pour Humain et Chien.

Aperçu rapide pour SRP14 anticorps (ABIN629979)

Antigène: SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SRP14 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SRP14 anticorps

Purification: Purified

Immunogène: SRP14 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SRP14 Blocking Peptide, (ABIN939973), is also available for use as a blocking control in assays to test for specificity of this SRP14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SRP14

Antigène: SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))

Autre désignation: SRP14

Sujet: SRP14 belongs to the SRP14 family. The signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.

Poids moléculaire: 15 kDa (MW of target protein)