SRP14 anticorps
-
- Antigène Voir toutes SRP14 Anticorps
- SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRP14 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- SRP14 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL
- Top Product
- Discover our top product SRP14 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SRP14 Blocking Peptide, catalog no. 33R-4587, is also available for use as a blocking control in assays to test for specificity of this SRP14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRP14 (Signal Recognition Particle 14kDa (Homologous Alu RNA Binding Protein) (SRP14))
- Autre désignation
- SRP14 (SRP14 Produits)
- Sujet
- SRP14 belongs to the SRP14 family. The signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.
- Poids moléculaire
- 15 kDa (MW of target protein)
-