KLHDC8A anticorps (C-Term)

N° du produit ABIN629982

Cet anticorps anti-KLHDC8A est un anticorps Lapin Polyclonal détectant KLHDC8A dans WB. Adapté pour Humain.

Aperçu rapide pour KLHDC8A anticorps (C-Term) (ABIN629982)

Antigène: KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHDC8A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KLHDC8A anticorps

Épitope: C-Term

Specificité: KLHDC8 A antibody was raised against the C terminal of KLHDC8

Purification: Purified

Immunogène: KLHDC8 A antibody was raised using the C terminal of KLHDC8 corresponding to a region with amino acids PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHDC8A Blocking Peptide, (ABIN5614374), is also available for use as a blocking control in assays to test for specificity of this KLHDC8A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHDC8A

Antigène: KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))

Autre désignation: KLHDC8A

Sujet: The function of KLHDC8A protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 39 kDa (MW of target protein)