PUF60 anticorps (C-Term)

N° du produit ABIN629984

L’anticorps Lapin Polyclonal anti-PUF60 a été validé pour WB et IHC. Il convient pour détecter PUF60 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PUF60 anticorps (C-Term) (ABIN629984)

Antigène: PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PUF60 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PUF60 anticorps

Épitope: C-Term

Specificité: PUF60 antibody was raised against the C terminal of PUF60

Purification: Purified

Immunogène: PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PUF60 Blocking Peptide, (ABIN5615676), is also available for use as a blocking control in assays to test for specificity of this PUF60 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUF60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PUF60

Antigène: PUF60 (Poly-U Binding Splicing Factor 60KDa (PUF60))

Autre désignation: PUF60

Sujet: PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.

Poids moléculaire: 58 kDa (MW of target protein)