OLA1 anticorps

N° du produit ABIN629990

L’anticorps Lapin Polyclonal anti-OLA1 a été validé pour WB et IHC. Il convient pour détecter OLA1 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour OLA1 anticorps (ABIN629990)

Antigène: OLA1 (Obg-Like ATPase 1 (OLA1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OLA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-OLA1 anticorps

Purification: Purified

Immunogène: GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWND

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GTPBP9 Blocking Peptide, (ABIN5613905), is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OLA1

Antigène: OLA1 (Obg-Like ATPase 1 (OLA1))

Autre désignation: GTPBP9

Sujet: GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.

Poids moléculaire: 44 kDa (MW of target protein)